PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462846211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family NAC
Protein Properties Length: 172aa    MW: 20016.9 Da    PI: 10.1052
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462846211genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1837.4e-5751301128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeel+++yL++kv++  +++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+++  g lv
  462846211   5 LPPGFRFHPTDEELITYYLTRKVSDFGFTT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFQ-AGMLV 102
                79*************************999.89***************999999****************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kktLvfy+grapkgekt+Wvmheyrl
  462846211 103 GMKKTLVFYRGRAPKGEKTSWVMHEYRL 130
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-613146IPR003441NAC domain
PROSITE profilePS5100555.8045148IPR003441NAC domain
PfamPF023655.0E-306130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELIT YYLTRKVSDF GFTTRAIADV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFQAGM LVGMKKTLVF YRGRAPKGEK  120
TSWVMHEYRL QNKFPYKPNK VLPHTFNQLA ATYIQARNGW CVGCSRSARS SR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-55513017142NO APICAL MERISTEM PROTEIN
1ut4_B5e-55513017142NO APICAL MERISTEM PROTEIN
1ut7_A5e-55513017142NO APICAL MERISTEM PROTEIN
1ut7_B5e-55513017142NO APICAL MERISTEM PROTEIN
3swm_A5e-55513020145NAC domain-containing protein 19
3swm_B5e-55513020145NAC domain-containing protein 19
3swm_C5e-55513020145NAC domain-containing protein 19
3swm_D5e-55513020145NAC domain-containing protein 19
3swp_A5e-55513020145NAC domain-containing protein 19
3swp_B5e-55513020145NAC domain-containing protein 19
3swp_C5e-55513020145NAC domain-containing protein 19
3swp_D5e-55513020145NAC domain-containing protein 19
4dul_A5e-55513017142NAC domain-containing protein 19
4dul_B5e-55513017142NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631711e-155AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.15e-98PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotO040176e-74NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLK4ACC86e-98K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m2e-97(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-88NAC domain containing protein 58